273 Ergebnisse - Zeige 81 von 100.

This report analyzes contract obligations for products, services, and research and development (R&D, ) by the U.S. Department of Defense (DoD), overall and by its key components (Air Force, Navy, Army and civilian agencies).

The Bilingual New Testament, English-Italian is derived from the 1901 English American Standard and Italian 1927 Riveduta Bible translations. Printed in 10-point text on white paper for easy reading, verses are paired in classical Biblical English and Italian so you can follow both translations sentence by sentence. Example verses: John 3:16 "For God so loved the world, that he gave his only begotten Son, that whosoever believeth on him should...

The second novel in an epic crossover trilogy uniting characters from every corner of the Star Trek universe, revealing the shocking origin and final fate of the Federation's most dangerous enemy—the Borg.On Earth, Federation President Nanietta Bacco gathers allies and adversaries to form a desperate last line of defense against an impending Borg invasion. In deep space, Captain Jean-Luc Picard and Captain Ezri Dax join together to cut off the...

VERB is a multi-ethnic national health campaign whose goal was to promote physical activity in U.S. tweens aged 9-13 years, in an effort to combat childhood obesity. The campaign was designed to reach multiple audiences of varying race and ethnicities as part of its sophisticated social marketing campaign. This book explores disparities that may exist in the tween population, through socio-economic status. Secondary data gathered by the Youth ...

In the early 1980s capillary liquid chromatography was being established, it was a period in which only a few research groups published a relatively small number of papers on the subject. In­ terest has since taken off, and a period of intense development, to which no end is yet in sight, is now upon us. More investiga­ tors and instrument-making firms are now entering the field. This greater interest has resulted in the rapid appearance of tw...

Mankind is living through a crucial period of its history. An arms race without precedent in intensity and duration, which developed in the postwar period, has left on our planet enor­ mous stockpiles of weaponry, which, should they be used in war, could cause irreparable damage to world civilization and even threaten the human race with extinction. Hence the most vital and urgent task in the world today is to end the arms race-as well as the ...

Recent scientific and industrial developments have demon­ strated the major effects (advantageous or otherwise) of trace components in compounds, which in commercial products may substantially affect the properties and the course of reactions, especially catalytic ones. Some of these problems (e.g., the pur­ ity of natural waters and air) have attracted the attention not only of specialists but also of society generally. It would be impossible...

This book is a sequel to my Chemical Thermodynamics: A Prob­ lems Approach published in 1967, which concerned classical thermodynamics almost exclusively. Most books on statistical thermodynamics now available are written either for the superior general chemistry student or for the specialist. The author has felt the need for a text which would bring the intermediate reader to the point where he could not only appreciate the roots of the subje...

There is currently great interest in the biology of soil, stimulated by an increased concern to conserve natural resources, not only in agriculture but also in natural ecosystems. Recent developments in molecular biology have increased the possibilities of manipulating soil organisms and the processes they carry out, to improve food production and the quality of the environment. But important environmental questions associated with the applica...

I am happy indeed to write a foreword to this book. Since it was founded, the A. F. Ioffe Institute in Leningrad has been in the forefront of semiconductor research. I visited it in 1934, and vividly remember A .. F. Ioffe himself and J. Frenkel and their kindness to me, and to others attending the meeting to celebrate the hundredth anniversary of Mendeleev. In the last years my own work on non-crystalline semiconductors has been strongly infl...

Particle dynamics in magnetic traps.- 1. Introduction. Budker¿s problem.- 2. Choice of unperturbed system.- 3. A few examples.- 4. Adiabatic perturbation.- 5. Insignificant effect of perturbation.- 6. Nonlinear resonances.- 7. Resonant ay ?¿.- 8. Mapping.- 9. Standard mapping.- 10. Limit of global stability.- 11. Local diffusion.- 12. Dynamic correlations.- 13. Global diffusion.- 14. Cohen¿s mapping.- 15. Remarks on adiabatic invariance.- Refe...

Technologiebasiertes und mobiles Lernen und Lehren sind in der Informations- und Wissensgesellschaft von zentraler Bedeutung. Ziel des Sammelbandes ist es, einen Blick in die nahe Zukunft des E- und M-Learnings zu werfen: der lebenslangen Aus- und Weiterbildung vom Vorschul- bis ins Rentenalter unter Verwendung von Rechnern und Rechnernetzwerken. Bei der Entwicklung solcher Angebote kommt es vor allem darauf an, ganzheitliche, integrierte Ansä...

Der Vertrieb als Bindeglied zwischen Kunden und Unternehmen beeinflusst vor allem durch die Akquise ganz wesentlich den Unternehmenserfolg. Dabei ist der Vertrieb auf IT-Unterstützung angewiesen. Die Gestaltung dieser Informationssysteme wird derzeit durch neue Trends herausgefordert. Dazu gehören u. a. die Individualisierung und Hybridisierung des Leistungsangebots. Der Autor stellt in seiner ganzheitlichen Betrachtung neue Ansätze zur Gestal...

Dienstleistung per Internet, moderne Logistik, steigender Zeit- und Kostendruck, erhöhte Qualitätsanforderungen: Dienstleister benötigen Werkzeuge zur integrierten Entwicklung von Software und Services. Das Ergebnis des Forschungsprojektes ServCASE bietet endlich das erforderliche Referenzmodell: exemplarische Vorgehensweisen, Methoden, die exakte Beschreibung einer werkzeugunterstützten Entwicklungsplattform. Konkret - in Theorie und Praxis.

Von Vermögensverwaltern und Finanzexperten erwartet man in der zwischen Gier und Angst pendelnden Marktstimmung professionelle Antworten auf wesentliche Fragestellungen. Dieses Buch beschäftigt sich mit dem Zustand des Weltfinanzsystems und den Schlussfolgerungen für die Zukunft. Dazu kommen in Interviews namhafte Experten deutscher Vermögensverwaltungen und Fondsgesellschaften zu Wort. Die von Thomas Gerner gestellten Fragen zielen darauf ab,...

Mit diesem Buch ermöglicht Hans-Jürgen Seelos die Anwendung der systemorientierten Managementlehre in der institutionalisierten Medizin. Als komplexen, non-trivialen (Dienstleistungs-)Systemen ist Medizinbetrieben a priori ein Management-Paradoxon implizit, das durch Grundkategorien einer systemisch-verhaltenswissenschaftlichen Managementlehre aufgelöst werden kann. Diese definieren einen Ordnungsrahmen sowohl für die Führung von Medizinbetrie...

La Creatividad, considerada una "habilidad" en la educación, que produciría ciudadanos imaginativos y flexibles, se concibe como una herramienta de cambio y conflicto cognitivo, que estimula y desarrolla aprendizajes, con conexiones duraderas y significativas, y por sobre todo, que tiende a la libertad de pensamiento, a darle seguridad y empoderamiento a cada ser humano en formación. Por ello, es de vital importancia discriminar si es posible ...

In Dash's Pause, the love of the Father chases a rabbit's heart through friendship, peril, trickery and rescue. The furry creature's real name and newfound courage gained by believing Truth lead him to embrace his story. The story is set in the historical context of a medieval monastery, where illuminated manuscripts were created to preserve the Word of God. Charming illustrations link the alphabet to Biblical character traits of God the Fathe...

La gestion des écosystèmes humides en milieu urbain est aujourd'hui très utile. Les grandes villes d'Afrique , déjà en proies aux pressions démographiques doivent faire face aux enjeux écologiques à travers: la gestion des déchets solides ménagers, la protection de la faune et de la flore des milieux humides et l'aménagement des espaces verts. La dépression de Zounvi est l'un des rares écosystèmes humides localisées dans la capitale de la Répu...

Durante el sigo XX la educación musical ha tenido una evolución importante. La problemática de esta investigación radica en el modo de articulación entre la actual formación pianística de los Educadores Musicales y su aplicación didáctica en relación con las necesidades en el campo laboral específico. El problema de investigación surge de observar la falta de tratamiento sistemático en una experiencia curricular concreta sobre dicha problemáti...